Daily Usenet report

Jul 14 01:00:01 -- Jul 15 01:00:00

Unknown entries from news log file:

First 50 / 159264 lines (0.0%)

Jul 14 01:00:01 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=reader2.newsxs.nl groups=alt.binaries.usenet2day message_id=_iteqcvquvlenofwulylzeodh-1784009892437_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 1840312868/716800"
Jul 14 01:00:01 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=reader2.newsxs.nl groups=alt.binaries.usenet2day message_id=_iteqcvquvlenofwulylzeodh-1784009892437_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:02 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.fz message_id=_4f5a743c0cbe40998e65b087411e5ec6_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 168995436/716800"
Jul 14 01:00:02 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.hitnews.com groups=alt.binaries.fz message_id=_4f5a743c0cbe40998e65b087411e5ec6_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:02 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=abp002.abavia.com groups=alt.binaries.wtfnzb.mike message_id=_tdjrzoejdrrrrkqwwmsblkes-1784009819914_private_ reason="Malformed yEnc: inconsistent declared sizes 14756227072/716800"
Jul 14 01:00:03 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx03.ams4.posted groups=alt.binaries.backup message_id=_a20c91a0228b4507a29b4e11db84da72_aewo_ reason="Malformed yEnc: inconsistent declared sizes 1953710334/716800"
Jul 14 01:00:03 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=fx03.ams4.posted groups=alt.binaries.backup message_id=_a20c91a0228b4507a29b4e11db84da72_aewo_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:04 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.tv message_id=_lregtscyrdnsnssmfcbgymws-1784010006861_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 1753255974/716800"
Jul 14 01:00:07 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=posting.uzoreto.com groups=alt.binaries.goat message_id=_nfhgqrvscwpswkpprrsgphsyrtdpdyqnhlhlx_jk_tyzdv.gi_r.oblr_ reason="Malformed yEnc: inconsistent declared sizes 200000000/768000"
Jul 14 01:00:08 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.a51_alt.binaries.ath_alt.binaries.frogs_alt.binaries.jph_alt.binaries.pwp message_id=_0ea3b5896f4a47649c710f0a7b37f528_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 67123172/716800"
Jul 14 01:00:09 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx02.ams4.posted groups=alt.binaries.backup message_id=_092735839ee941389f8739551ca820b1_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 16568605252/716800"
Jul 14 01:00:10 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=usenetnews.net groups=alt.binaries.wtfnzb.echo message_id=_sxtfmcijvxpnjrmmdvyalwla-1784010012217_private_ reason="Malformed yEnc: inconsistent declared sizes 250000000/716800"
Jul 14 01:00:10 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=usenetnews.net groups=alt.binaries.wtfnzb.echo message_id=_sxtfmcijvxpnjrmmdvyalwla-1784010012217_private_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:11 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.lima message_id=_bnfzqnczljpfdlsxkvdztzyh-1784009587322_private_ reason="Malformed yEnc: inconsistent declared sizes 5321259008/716800"
Jul 14 01:00:12 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.xylo message_id=_2c8e3855f5354eb585034324dea4b196_ngpost.com_ reason="Malformed yEnc: inconsistent declared sizes 2800746496/716800"
Jul 14 01:00:12 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx13.ams4.posted groups=alt.binaries.storage message_id=_cd4ef4cd19a848afb8111958247fa6f2_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 1048576000/716800"
Jul 14 01:00:12 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=fx13.ams4.posted groups=alt.binaries.storage message_id=_cd4ef4cd19a848afb8111958247fa6f2_ngpost_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:13 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.beta message_id=_seouldggkrdzwwibxjkztibs-1784010242183_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 500000000/716800"
Jul 14 01:00:13 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.boneless_alt.binaries.hdtv.x264_alt.binaries.nl message_id=_ezsmsq0hr9pb2z5x9phu_jbinup.local_ reason="Malformed yEnc: inconsistent declared sizes 150000000/640000"
Jul 14 01:00:20 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx06.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_tsxdbhisbhnuuakqlgqofmac-1784010312860_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 23651674310/716800"
Jul 14 01:00:20 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.dvd.midnightmovies message_id=_3f7bf800d06346dba5c05c63cf4185e0_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 998244352/716800"
Jul 14 01:00:20 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.hitnews.com groups=alt.binaries.dvd.midnightmovies message_id=_3f7bf800d06346dba5c05c63cf4185e0_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:21 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx04.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_xtktsbnnjrppwnxmncneqhaf-1784009884442_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 42343209489/716800"
Jul 14 01:00:22 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.delta message_id=_qdrnchcbobhzarkanhsvbvak-1784010126273_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 300000000/716800"
Jul 14 01:00:22 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=abp003.abavia.com groups=alt.binaries.wtfnzb.juliet message_id=_qwxhzfaecdjoijapnptswnix-1784009943523_private_ reason="Malformed yEnc: inconsistent declared sizes 14756227072/716800"
Jul 14 01:00:23 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.a51_alt.binaries.ath_alt.binaries.frogs_alt.binaries.jph_alt.binaries.pwp message_id=_cce43b51e760454faa6176d11c1f0677_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 104857600/716800"
Jul 14 01:00:23 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.hitnews.com groups=alt.binaries.a51_alt.binaries.ath_alt.binaries.frogs_alt.binaries.jph_alt.binaries.pwp message_id=_cce43b51e760454faa6176d11c1f0677_ngpost_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:24 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.golf message_id=_zslrcjtzzvuyfmbpmloyhyxt-1784010246411_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 500000000/716800"
Jul 14 01:00:24 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.comp message_id=_9uzknlfrm92.j.w.ruiciqg.tl_jmfaiwurn_a10a74sl4.44npg_ reason="Malformed yEnc: inconsistent declared sizes 492111656/768000"
Jul 14 01:00:24 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.usenet.farm groups=alt.binaries.comp message_id=_9uzknlfrm92.j.w.ruiciqg.tl_jmfaiwurn_a10a74sl4.44npg_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:25 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.dvd.midnightmovies message_id=_329a0bd1a6904077b4b0f854467fc069_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 998244352/716800"
Jul 14 01:00:26 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.cheapnews.eu groups=alt.binaries.multimedia.alias message_id=_tv0f96pzw4hvdgsise7vzc2l_4sfiaaodzskn.5gt_ reason="Malformed yEnc: inconsistent declared sizes 2118989871/716800"
Jul 14 01:00:26 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=abp003.abavia.com groups=alt.binaries.wtfnzb.mike message_id=_zzfrskkfjtvgyesqoknnzaxk-1784010483139_private_ reason="Malformed yEnc: inconsistent declared sizes 7196507795/716800"
Jul 14 01:00:27 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=reader2.newsxs.nl groups=alt.binaries.encrypted message_id=_bab741d904ee4b2a9590b4d6ba023a89_ngpost_ reason="Malformed yEnc: inconsistent declared sizes 354749144/716800"
Jul 14 01:00:27 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=reader2.newsxs.nl groups=alt.binaries.encrypted message_id=_bab741d904ee4b2a9590b4d6ba023a89_ngpost_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:28 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=fx01.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_attazmbjjnhnbusqryqfsdvc-1784010418739_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 3774524088/716800"
Jul 14 01:00:28 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=fx01.ams4.posted groups=alt.binaries.misc_alt.binaries.movie message_id=_attazmbjjnhnbusqryqfsdvc-1784010418739_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:28 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.hunters message_id=_e2db1d8d27bb43ef9136052580d2a213_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 337013968/716800"
Jul 14 01:00:29 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.lima message_id=_wctkvvwgeuzbctljttzqwvza-1784010049991_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 500000000/716800"
Jul 14 01:00:29 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.hitnews.com groups=alt.binaries.cats message_id=_c95cab7d4e7a47b3afc4c4e061c789f8_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 214958080/716800"
Jul 14 01:00:30 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=usenetnews.net groups=alt.binaries.wtfnzb.kilo message_id=_pmtklqmfloeeegrvuwfegcvc-1784010005815_private_ reason="Malformed yEnc: inconsistent declared sizes 250000000/716800"
Jul 14 01:00:30 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=usenetnews.net groups=alt.binaries.wtfnzb.kilo message_id=_pmtklqmfloeeegrvuwfegcvc-1784010005815_private_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:31 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=gru.netnews.com groups=alt.binaries.u4e message_id=_18c213b17c899cb8.19294.31ae7b01c7535e22_hkatfpfgdxwnpx.net_ reason="Malformed yEnc: inconsistent declared sizes 7731463203/768000"
Jul 14 01:00:31 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=gru.netnews.com groups=alt.binaries.u4e message_id=_18c213b17c899cb8.19294.31ae7b01c7535e22_hkatfpfgdxwnpx.net_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:32 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.ftn message_id=_4_0_jzfqvctht.1tdcchlr6p_js0alaq.hq44_ reason="Malformed yEnc: inconsistent declared sizes 492111656/768000"
Jul 14 01:00:32 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.usenet.farm groups=alt.binaries.ftn message_id=_4_0_jzfqvctht.1tdcchlr6p_js0alaq.hq44_ reason="Binary byte profile: nonprintable ratio 11%"
Jul 14 01:00:32 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.cheapnews.eu groups=alt.binaries.sleazemovies message_id=_f0ii1vxxnk8gh1x7fc7uis6z_ygb5t79cxn27.nzz_ reason="Malformed yEnc: inconsistent declared sizes 2131702827/716800"
Jul 14 01:00:33 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=posting.uzoreto.com groups=alt.binaries.encrypted message_id=_ngoa0goa4crr0tmbo6u_075b53610971ea50euvb9bu7q9lbwrh_ reason="Malformed yEnc: inconsistent declared sizes 447741952/768000"
Jul 14 01:00:33 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=malformed.encoding peer=news.usenet.farm groups=alt.binaries.wtfnzb.bravo message_id=_cxhspwertdznrdfvulpbyqpj-1784010053986_nyuu_ reason="Malformed yEnc: inconsistent declared sizes 300000000/716800"
Jul 14 01:00:33 gallifrey innd[25710]: filter: cleanfeed_event action=audit rule=binary.byte_profile peer=news.usenet.farm groups=alt.binaries.wtfnzb.bravo message_id=_cxhspwertdznrdfvulpbyqpj-1784010053986_nyuu_ reason="Binary byte profile: nonprintable ratio 11%"

Outgoing feeds (innfeed) by volume:

ServerAcceptVolRejectVolTotalVolVolume/secVol/ArtElapsed
1nntp.club.cc.cmu.edu23.0 GB1.9 MB23.0 GB279.1 KB/s691.8 KB23:57:16
2news.quux.org574.1 KB0.0 KB574.1 KB0.0 KB/s5.1 KB23:55:27
3news.nntp4.net570.7 KB0.0 KB570.7 KB0.0 KB/s5.1 KB23:55:27
4newsfeed.endofthelinebbs.com558.5 KB24.6 KB583.0 KB0.0 KB/s5.1 KB23:55:27
5news.snarked.org558.1 KB18.3 KB576.3 KB0.0 KB/s5.1 KB23:55:27
6nntp.comgw.net531.9 KB0.0 KB531.9 KB0.0 KB/s5.2 KB23:55:27
7news.sonologic.net531.5 KB49.3 KB580.8 KB0.0 KB/s4.9 KB23:55:27
8nk-in.news.weretis.net423.7 KB0.0 KB423.7 KB0.0 KB/s5.6 KB23:55:27
9feeder.erje.net269.6 KB59.9 KB329.5 KB0.0 KB/s4.0 KB24:02:47
10news.trigofacile.com2.1 KB0.0 KB2.1 KB0.0 KB/s2.1 KB14:25:51
11aioe.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
12chmurka.net0.0 KB0.0 KB0.0 KB0.0 KB/s000:20:00
13de-l.enfer-du-nord.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
14feed.le-studio75.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
15hal-mli.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
16just2write2.myftp.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
17mccarragher.com0.0 KB0.0 KB0.0 KB0.0 KB/s024:01:42
18nedknow-in.feed.uzoreto.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
19neva.ru0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:27
20news.albasani.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
21news.buerger.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:27
22news.corradoroberto.it0.0 KB

Log entries by program:

Program nameLines%LinesSize%Size
innd 222234 60.1%50.0 MB 64.0%
inn 138767 37.5%26.7 MB 34.2%
innfeed 8070 2.2%1.3 MB 1.6%
nnrpd 928 0.3%165.7 KB 0.2%
nocem 42 0.0%6.9 KB 0.0%
controlchan 13 0.0%2.8 KB 0.0%
overchan 2 0.0%0.2 KB 0.0%
pgpverify 1 0.0%0.3 KB 0.0%
TOTAL: 8 370057 100.0%78.2 MB100.0%

Control commands to innd:

CommandNumber
go 96
logmode 1
mode 147
name 2
pause 97
renumber 1
reserve 2
shutdown 3
TOTAL: 8 349

Control channel:

SendernewgrouprmgroupOtherBad PGPDoItOK
newgroups-request@fido7.org001101
TOTAL001101

Incoming feeds (innd):

ServerConnectsOfferedTakenRefusedReject%AccptElapsed
1newsfeed.bofh.team 6153 123129 33519 988 88622 27%5659:38:15
2feeder.erje.net 22 6911 853 4399 1659 12%52:09:06
3nk-out.news.weretis.net 17 9307 673 7245 1389 7%41:32:27
4news.quux.org 12 4797 447 3642 708 9%29:23:54
5news.dne3.net 15 5800 419 4372 1009 7%24:50:22
6news.nntp4.net 16 6100 413 4584 1103 6%24:27:04
7news.sonologic.net 12 5423 371 4242 810 6%23:52:37
8newsfeed.endofthelinebbs.com 10 4639 319 3418 902 6%23:54:02
9news.snarked.org 339 4401 303 3445 653 6%77:39:07
10nntp.club.cc.cmu.edu 584 7719 192 6702 825 2%46:12:11
11nk-out.news.chmurka.net 6 1919 163 1483 273 8%23:56:11
12nntp.comgw.net 3 1460 157 1012 291 10%23:57:49
13localhost 115 115 114 0 1 99%00:27:05
14news.corradoroberto.it 5 1861 98 1458 305 5%23:54:58
15news.trigofacile.com 33 283 14 234 35 4%15:36:13
TOTAL: 15 7342 183864 38055 47224 98585 20%6091:31:21
Articles received by server0.0 KB
0.0 KB0.0 KB/s021:11:14
23news.dne3.net0.0 KB0.0 KB0.0 KB0.0 KB/s000:20:00
24news.furie.co.uk0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
25news.gabrix.ath.cx0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
26news.hub.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
27news.iridiumlinux.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
28news.ripco.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
29news.spacesst.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
30news.telesweet.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:53:51
31news.ycache.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:53:51
32newsfeed.bofh.team0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:27
33newsfeed.fsmpi.rwth-aachen.de0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
34newsfeed.news4us.nl0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
35newsfeed.x-privat.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
36newsfeed1.swip.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
37nyheter.lysator.liu.se0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
38peer.alt119.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
39sonarsouth.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
40tranquility.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
41uca516916.inbound.news.uu.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:13
42usenet.blueworldhosting.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:53:05
TOTAL: 4223.0 GB2.0 MB23.0 GB7.1 KB/s675.8 KB945:56:32
Outgoing feeds (innfeed) by volume
width="550" height="405" src="pics/innfeed_volume.2026.07.14-01.00.01.png"/>

NNRP readership statistics [Top 100]:

SystemConnArtsSizeGroupsPostRejElapsed
1doctor.nl2k.ab.ca 140 10624.0 MB 155 112 4426:53:29
2ts1p16.nl2k.ab.ca 2 11.7 KB 1 0 000:02:25
3uucp.nk.ca 2 10.7 KB 1 1 000:01:37
TOTAL: 3 144 10644.0 MB 157 113 4426:57:33

NNRP connection statistics (by domain) [Top 100]:

SystemConnArtsSizeGroupsPostRejElapsed
1*.nl2k.ab.ca 142 10634.0 MB 156 112 4426:55:55
2*.nk.ca 3 10.7 KB 1 1 000:01:37
3*.monitoring.internet-measurement.com 21 00.0 KB 0 0 000:00:12
4*.167.censys-scanner.com 10 00.0 KB 0 0 000:00:02
5*.66.censys-scanner.com 9 00.0 KB 0 0 000:00:21
TOTAL: 5 185 10644.0 MB 157 113 4426:58:10

Incoming volume (innd):

ServerAcceptVolDupVolRejVolTotalVol%AccVol/Art
1newsfeed.bofh.team22.5 GB628.6 MB65.9 GB89.0 GB 25%763.6 KB
2news.sonologic.net3.2 MB5.7 MB756.9 KB9.6 MB 32%8.3 KB
3news.quux.org2.5 MB6.4 MB310.0 KB9.1 MB 26%8.1 KB
4feeder.erje.net2.2 MB3.1 MB2.7 MB7.9 MB 27%3.2 KB
5newsfeed.endofthelinebbs.com2.1 MB6.9 MB1.3 MB10.3 MB 20%8.6 KB
6nk-out.news.weretis.net1.9 MB4.2 MB700.7 KB6.8 MB 28%3.4 KB
7news.dne3.net1.8 MB13.4 MB7.8 MB22.9 MB 7%16.5 KB
8news.nntp4.net1.6 MB8.1 MB13.6 MB23.3 MB 6%15.8 KB
9nntp.comgw.net1.2 MB3.0 MB2.6 MB6.8 MB 18%15.6 KB
10news.snarked.org967.0 KB2.6 MB964.6 KB4.5 MB 21%4.8 KB
11localhost579.4 KB0.0 KB2.7 KB582.1 KB 99%5.1 KB
12nntp.club.cc.cmu.edu540.2 KB2.0 MB601.5 KB3.2 MB 16%3.2 KB
13nk-out.news.chmurka.net444.6 KB1.0 MB76.7 KB1.5 MB 28%3.6 KB
14news.corradoroberto.it212.4 KB1.0 MB88.7 KB1.3 MB 15%3.3 KB
15news.trigofacile.com32.5 KB116.1 KB6.1 KB154.7 KB 21%3.2 KB
TOTAL: 1522.5 GB686.1 MB65.9 GB89.1 GB 25%683.4 KB
Incoming volume received by server

NNRP total resource statistics [Top 20]:

SystemUser(ms)System(ms)Idle(ms)Elapsed
doctor.nl2k.ab.ca 14.557 22.666 0.000426:53:29
ts1p16.nl2k.ab.ca 0.188 0.099 0.00000:02:25
uucp.nk.ca 0.207 0.079 0.00000:01:37
159.186.132.66.censys-scanner.com 1.822 0.110 0.00000:00:16
91.195.132.66.censys-scanner.com 1.688 0.033 0.00000:00:05
r4-143-8f.monitoring.internet-measurement.com 0.233 0.008 0.00000:00:02
62.146.94.167.censys-scanner.com 2.341 0.064 0.00000:00:02
r4-216-d8.monitoring.internet-measurement.com 0.476 0.016 0.00000:00:01
r5-129-81.monitoring.internet-measurement.com 0.231 0.022 0.00000:00:01
r4-190-be.monitoring.internet-measurement.com 0.252 0.000 0.00000:00:00
r4-198-c6.monitoring.internet-measurement.com 0.244 0.008 0.00000:00:00
r5-196-c4.monitoring.internet-measurement.com 0.244 0.008 0.00000:00:00
r3-189-bd.monitoring.internet-measurement.com 0.250 0.000 0.00000:00:00
10.210.203.35.bc.googleusercontent.com 0.250 0.000 0.00000:00:00
r5-194-c2.monitoring.internet-measurement.com 0.225 0.016 0.00000:00:00
r5-215-d7.monitoring.internet-measurement.com 0.231 0.008 0.00000:00:00
221.211.203.35.bc.googleusercontent.com 0.144 0.052 0.00000:00:00
gallifrey.nk.ca 0.074 0.033 0.00000:00:00
53.146.94.167.censys-scanner.com 0.207 0.107 0.00000:00:00
172-234-217-129.ip.linodeusercontent.com 0.132 0.066 0.00000:00:00
TOTAL: 39 27.616 23.765 0.000426:58:12
width="550" height="455" src="pics/innd_incoming_vol.2026.07.14-01.00.01.png"/>

Curious NNRP explorers [Top 20]:

SystemConn
62.146.94.167.censys-scanner.com 10
159.186.132.66.censys-scanner.com 8
91.195.132.66.censys-scanner.com 7
53.146.94.167.censys-scanner.com 3
172-234-217-129.ip.linodeusercontent.com 2
221.211.203.35.bc.googleusercontent.com 2
azpdsskv2v8p.stretchoid.com 2
r4-216-d8.monitoring.internet-measurement.com 2
10.210.203.35.bc.googleusercontent.com 1
198.235.24.196 1
216.226.76.20 1
69.5.169.69 1
69.5.169.88 1
gallifrey.nk.ca 1
r3-185-b9.monitoring.internet-measurement.com 1
r3-186-ba.monitoring.internet-measurement.com 1
r3-189-bd.monitoring.internet-measurement.com 1
r3-4-4.monitoring.internet-measurement.com 1
r3-8-8.monitoring.internet-measurement.com 1
r4-10-a.monitoring.internet-measurement.com 1
TOTAL: 39 67

NNRP no permission clients [Top 20]:

SystemConn
91.195.132.66.censys-scanner.com 4
53.146.94.167.censys-scanner.com 3
159.186.132.66.censys-scanner.com 2
172-234-217-129.ip.linodeusercontent.com 2
221.211.203.35.bc.googleusercontent.com 2
azpdsskv2v8p.stretchoid.com 2
10.210.203.35.bc.googleusercontent.com 1
198.235.24.196 1
216.226.76.20 1
69.5.169.69 1
69.5.169.88 1
r3-189-bd.monitoring.internet-measurement.com 1
r4-190-be.monitoring.internet-measurement.com 1
r4-198-c6.monitoring.internet-measurement.com 1
r4-216-d8.monitoring.internet-measurement.com 1
r5-129-81.monitoring.internet-measurement.com 1
r5-196-c4.monitoring.internet-measurement.com 1
TOTAL: 17 26

NNRP gethostbyaddr failures [Top 20]:

SystemConn
? (can't getpeername) 7
TOTAL: 1 7

NNRP unrecognized commands (by host) [Top 20]:

SystemConn
doctor.nl2k.ab.ca 8
uucp.nk.ca 1
TOTAL: 2 9

NNRP unrecognized commands (by command) [Top 20]:

CommandCount
XTHREAD DBINIT 9
TOTAL: 1 9

NNRP client timeouts [Top 20]:

SystemConnPeer
doctor.nl2k.ab.ca 10 0
TOTAL: 1 10 0

Newsgroup request counts (by hierarchy) [Top 100]:

HierarchyCountPct
1rec 834 80.3%
2can 100 9.6%
3microsoft 30 2.9%
4comp 26 2.5%
5alt 19 1.8%
6news 16 1.5%
7edm 9 0.9%
8soc 5 0.5%
TOTAL: 8 1039100.0%

Newsgroup request counts (by newsgroup) [Top 100]:

NewsgroupCount
1rec.arts.drwho 755
2can.politics 98
3rec.sport.soccer 55
4microsoft.public.windowsxp.help_and_support 30
5news.software.nntp 16
6rec.arts.sf.written 14
7comp.lang.c++ 10
8alt.christnet.christianlife 8
9comp.lang.javascript 8
10alt.christnet.bible 6
11edm.general 6
12comp.lang.c 4
13comp.os.linux.misc 4
14rec.arts.sf.fandom 4
15rec.arts.sf.tv 4
16soc.culture.europe 4
17alt.christnet 3
18edm.news.stats 3
19alt.christnet.prayer 2
20can.general 2
21rec.arts.sf.starwars.misc 2
22soc.culture.esperanto 1
TOTAL: 22 1039
innreport from INN 2.8.0 (20260714 snapshot) based on initial work (©) 1996-2001 by Fabien Tassin <fta@sofaraway.org> and enhanced by several contributors since then

Incoming articles (innd):

DateArticles%ArtsArt/secSize%SizeKB/sec
Jul 14 01:00:01 - 01:59:59 1463 3.8% 0.41946.7 MB 4.0% 269.36
Jul 14 02:00:00 - 02:59:59 1530 4.0% 0.42933.6 MB 4.0% 265.55
Jul 14 03:00:00 - 03:59:59 1632 4.2% 0.45989.6 MB 4.2% 281.50
Jul 14 04:00:00 - 04:59:59 1722 4.5% 0.48999.7 MB 4.3% 284.35
Jul 14 05:00:00 - 05:59:59 1616 4.2% 0.45868.4 MB 3.7% 247.01
Jul 14 06:00:00 - 06:59:59 1600 4.2% 0.44937.0 MB 4.0% 266.53
Jul 14 07:00:00 - 07:59:59 2012 5.2% 0.561.2 GB 5.1% 339.83
Jul 14 08:00:00 - 08:59:59 1747 4.5% 0.49965.3 MB 4.1% 274.57
Jul 14 09:00:00 - 09:59:59 1738 4.5% 0.48868.8 MB 3.7% 247.12
Jul 14 10:00:00 - 10:59:59 1511 3.9% 0.42821.6 MB 3.5% 233.71
Jul 14 11:00:00 - 11:59:59 1483 3.9% 0.41882.5 MB 3.8% 251.01
Jul 14 12:00:00 - 12:59:59 1697 4.4% 0.471.0 GB 4.4% 293.52
Jul 14 13:00:00 - 13:59:59 1749 4.5% 0.491011.8 MB 4.3% 287.81
Jul 14 14:00:00 - 14:59:59 1933 5.0% 0.541.2 GB 5.1% 340.98
Jul 14 15:00:00 - 15:59:59 1829 4.7% 0.511.1 GB 4.7% 315.07
Jul 14 16:00:00 - 16:59:59 1579 4.1% 0.44945.4 MB 4.0% 268.92
Jul 14 17:00:00 - 17:59:59 1497 3.9% 0.42947.4 MB 4.0% 269.47
Jul 14 18:00:00 - 18:59:59 1458 3.8% 0.41945.6 MB 4.0% 268.98
Jul 14 19:00:00 - 19:59:59 1404 3.6% 0.39971.2 MB 4.1% 276.26
Jul 14 20:00:00 - 20:59:59 1534 4.0% 0.431.1 GB 4.8% 318.88
Jul 14 21:00:00 - 21:59:59 1204 3.1% 0.33852.4 MB 3.6% 242.47
Jul 14 22:00:00 - 22:59:59 1344 3.5% 0.37897.6 MB 3.8% 255.33
Jul 14 23:00:00 - 23:59:59 1644 4.3% 0.461.0 GB 4.5% 304.02
Jul 15 00:00:00 - 01:00:00 1591 4.1% 0.441002.3 MB 4.3% 285.09
TOTAL: 23:59:59 38517 100.0% 0.4523.0 GB 100.0% 278.64
Incoming articles
Incoming articles (size)

Sites sending bad articles:

ServerTotalGroupDistDuplicUnappTooOldSiteLineOther
1newsfeed.bofh.team 89936 84764 0 941 4 01682 0 2545
2feeder.erje.net 1721 400 0 773 1 0 232 0 315
3nk-out.news.weretis.net 1564 52 0 1299 0 0 108 0 105
4news.nntp4.net 1131 74 0 786 2 0 47 0 222
5news.dne3.net 1063 27 0 774 0 0 84 0 178
6newsfeed.endofthelinebbs.com 913 91 0 701 0 0 55 0 66
7nntp.club.cc.cmu.edu 826 122 0 607 0 0 65 0 32
8news.sonologic.net 806 76 0 692 0 0 36 0 2
9news.quux.org 668 52 0 611 0 0 5 0 0
10news.snarked.org 654 84 0 541 1 0 25 0 3
11nntp.comgw.net 355 20 0 227 0 0 32 0 76
12news.corradoroberto.it 302 14 0 279 0 0 9 0 0
13nk-out.news.chmurka.net 272 19 0 252 0 0 1 0 0
14news.trigofacile.com 36 3 0 32 0 0 0 0 1
15localhost 1 0 0 0 0 0 0 0 1
TOTAL: 15100248 85798 0 8515 8 02381 0 3546

Unwanted newsgroups [Top 20]:

NewsgroupCount
alt.binaries.ninja.michelangelo 4618
alt.binaries.encrypted 4567
alt.binaries.font 1891
alt.binaries.backup 1804
alt.binaries.multimedia.anime.highspeed 1589
alt.binaries.xylo 1552
alt.binaries.nordic.password.protected 1516
alt.binaries.storage 1495
alt.binaries.conspiracy 1462
alt.binaries.erotica.sex 1461
alt.binaries.erotica.erotica 1404
alt.binaries.nzb 1284
alt.binaries.ucc 1262
alt.binaries.dump 1252
alt.binaries.astronomy 1249
alt.binaries.ufg 1219
alt.binaries.amazing 1208
alt.binaries.echange-web 1141
alt.binaries.ftn 1097
alt.binaries.fta 1066
TOTAL: 270 85798

Supposedly-moderated groups with unmoderated postings [Top 20]:

GroupsCount
alt.binaries.atari 4
christnet.bible 3
fr.sci.geosciences 1
TOTAL: 3 8

Unwanted sites in Path header field [Top 20]:

SiteCount
news.newsdemon.com 1787
news.neodome.net 577
news.mixmin.net 17
TOTAL: 3 2381

Perl filter (innd) [Top 20]:

ReasonCount
[CF-OTHER] User-issued cancel 455
[CF-OTHER] EMP (md5) 310
[CF-OTHER] Binary Image: misplaced jpg 208
[CF-CROSSPOST] Too many newsgroups (meow) 4
[CF-OTHER] HTML Multipart 2
[CF-BINARY-MIME] Binary: misplaced binary 1
[CF-OTHER] Binary Image: misplaced png 1
TOTAL: 7 981

NoCeM on spool:

Issuer (type)NoticesBad PGPCancelSkipTotal
robot@pasdenom.info (spam2)20002424
robot@pasdenom.info (spam3)20066
robot@pasdenom.info (spam4)10011
TOTAL: 323003131

Miscellaneous innd events:

EventsCount
RCreader 1
TOTAL: 1 1

Miscellaneous innd statistics [Top 10]:

EventServerNumber
Bad command received
newsfeed.bofh.team 19828
TOTAL: 1 19828
Huge articles
newsfeed.bofh.team 2356
TOTAL: 1 2356
Including strange strings
newsfeed.bofh.team 12
news.dne3.net 1
nk-out.news.weretis.net 1
news.nntp4.net 1
newsfeed.endofthelinebbs.com 1
feeder.erje.net 1
TOTAL: 6 17
No colon-space in header field
newsfeed.bofh.team 8
TOTAL: 1 8
TOTAL: 4 22209

Outgoing feeds (innfeed) by articles:

ServerOfferedTakenRefusedRejectMissSpool%TookElapsed
1nntp.club.cc.cmu.edu 39647 34177 3537 619 0 16 86%23:57:16
2news.quux.org 4154 113 4041 0 0 0 2%23:55:27
3news.nntp4.net 4001 111 3889 0 0 0 2%23:55:27
4news.sonologic.net 4221 110 4068 8 0 0 2%23:55:27
5news.snarked.org 4194 109 4078 3 0 0 2%23:55:27
6newsfeed.endofthelinebbs.com 5930 107 4041 7 0 0 1%23:55:27
7nntp.comgw.net 4357 102 4243 0 0 0 2%23:55:27
8nk-in.news.weretis.net 4626 75 4528 0 0 0 1%23:55:27
9feeder.erje.net 3127 70 3016 12 0 0 2%24:02:47
10news.trigofacile.com 217 1 206 0 0 17 0%14:25:51
11news.corradoroberto.it 527 0 526 0 0 1 0%21:11:14
12aioe.org 0 0 0 0 0 4532 0%23:56:32
13chmurka.net 0 0 0 0 0 0 0%00:20:00
14de-l.enfer-du-nord.net 0 0 0 0 0 4592 0%23:56:32
15feed.le-studio75.com 0 0 0 0 0 38482 0%23:56:32
16hal-mli.net 0 0 0 0 0 0 0%23:56:32
17just2write2.myftp.org 0 0 0 0 0 4557 0%23:56:32
18mccarragher.com 0 0 0 0 0 4615 0%24:01:42
19nedknow-in.feed.uzoreto.com 0 0 0 0 0 38482 0%23:56:32
20neva.ru 0 0 0 0 0 4574 0%23:55:27
21news.albasani.net 0 0 0 0 0 4602 0%23:56:32
22news.buerger.net 0 0 0 0 0 4612 0%23:55:27
23news.dne3.net 0 0 0 0 0 0 0%00:20:00
24news.furie.co.uk 0 0 0 0 0 38482 0%23:56:32
25news.gabrix.ath.cx 0 0 0 0 0 4540 0%23:56:32
26news.hub.org 0 0 0 0 0 471 0%23:56:32
27news.iridiumlinux.org 0 0 0 0 0 1999 0%23:56:32
28news.ripco.com 0 0 0 0 0 4533 0%23:56:32
29news.spacesst.com 0 0 0 0 0 4602 0%23:56:32
30news.telesweet.net 0 0 0 0 0 4601 0%23:53:51
31news.ycache.com 0 0 0 0 0 4555 0%23:53:51
32newsfeed.bofh.team 0 0 0 0 0 4238 0%23:55:27
33newsfeed.fsmpi.rwth-aachen.de 0 0 0 0 0 4592 0%23:56:32
34newsfeed.news4us.nl 0 0 0 0 0 4592 0%23:56:32
35newsfeed.x-privat.org 0 0 0 0 0 4604 0%23:56:32
36newsfeed1.swip.net 0 0 0 0 0 0 0%23:56:32
37nyheter.lysator.liu.se 0 0 0 0 0 38480 0%23:56:32
38peer.alt119.net 0 0 0 0 0 4611 0%23:56:32
39sonarsouth.com 0 0 0 0 0 0 0%23:56:32
40tranquility.net 0 0 0 0 0 4602 0%23:56:32
41uca516916.inbound.news.uu.net 0 0 0 0 0 38443 0%23:55:13
42usenet.blueworldhosting.com 0 0 0 0 0 3888 0%23:53:05
TOTAL: 42 75001 34975 36173 649 0 280915 46%945:56:32
Outgoing feeds (innfeed) by articles

Outgoing feeds (innfeed) by volume:

ServerAcceptVolRejectVolTotalVolVolume/secVol/ArtElapsed
1nntp.club.cc.cmu.edu23.0 GB1.9 MB23.0 GB279.1 KB/s691.8 KB23:57:16
2news.quux.org574.1 KB0.0 KB574.1 KB0.0 KB/s5.1 KB23:55:27
3news.nntp4.net570.7 KB0.0 KB570.7 KB0.0 KB/s5.1 KB23:55:27
4newsfeed.endofthelinebbs.com558.5 KB24.6 KB583.0 KB0.0 KB/s5.1 KB23:55:27
5news.snarked.org558.1 KB18.3 KB576.3 KB0.0 KB/s5.1 KB23:55:27
6nntp.comgw.net531.9 KB0.0 KB531.9 KB0.0 KB/s5.2 KB23:55:27
7news.sonologic.net531.5 KB49.3 KB580.8 KB0.0 KB/s4.9 KB23:55:27
8nk-in.news.weretis.net423.7 KB0.0 KB423.7 KB0.0 KB/s5.6 KB23:55:27
9feeder.erje.net269.6 KB59.9 KB329.5 KB0.0 KB/s4.0 KB24:02:47
10news.trigofacile.com2.1 KB0.0 KB2.1 KB0.0 KB/s2.1 KB14:25:51
11aioe.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
12chmurka.net0.0 KB0.0 KB0.0 KB0.0 KB/s000:20:00
13de-l.enfer-du-nord.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
14feed.le-studio75.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
15hal-mli.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
16just2write2.myftp.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
17mccarragher.com0.0 KB0.0 KB0.0 KB0.0 KB/s024:01:42
18nedknow-in.feed.uzoreto.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
19neva.ru0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:27
20news.albasani.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
21news.buerger.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:27
22news.corradoroberto.it0.0 KB0.0 KB0.0 KB0.0 KB/s021:11:14
23news.dne3.net0.0 KB0.0 KB0.0 KB0.0 KB/s000:20:00
24news.furie.co.uk0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
25news.gabrix.ath.cx0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
26news.hub.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
27news.iridiumlinux.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
28news.ripco.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
29news.spacesst.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
30news.telesweet.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:53:51
31news.ycache.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:53:51
32newsfeed.bofh.team0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:27
33newsfeed.fsmpi.rwth-aachen.de0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
34newsfeed.news4us.nl0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
35newsfeed.x-privat.org0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
36newsfeed1.swip.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
37nyheter.lysator.liu.se0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
38peer.alt119.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
39sonarsouth.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
40tranquility.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:56:32
41uca516916.inbound.news.uu.net0.0 KB0.0 KB0.0 KB0.0 KB/s023:55:13
42usenet.blueworldhosting.com0.0 KB0.0 KB0.0 KB0.0 KB/s023:53:05
TOTAL: 4223.0 GB2.0 MB23.0 GB7.1 KB/s675.8 KB945:56:32
Outgoing feeds (innfeed) by volume

NNRP readership statistics [Top 100]:

SystemConnArtsSizeGroupsPostRejElapsed
1doctor.nl2k.ab.ca 140 10624.0 MB 155 112 4426:53:29
2ts1p16.nl2k.ab.ca 2 11.7 KB 1 0 000:02:25
3uucp.nk.ca 2 10.7 KB 1 1 000:01:37
TOTAL: 3 144 10644.0 MB 157 113 4426:57:33

NNRP connection statistics (by domain) [Top 100]:

SystemConnArtsSizeGroupsPostRejElapsed
1*.nl2k.ab.ca 142 10634.0 MB 156 112 4426:55:55
2*.nk.ca 3 10.7 KB 1 1 000:01:37
3*.monitoring.internet-measurement.com 21 00.0 KB 0 0 000:00:12
4*.167.censys-scanner.com 10 00.0 KB 0 0 000:00:02
5*.66.censys-scanner.com 9 00.0 KB 0 0 000:00:21
TOTAL: 5 185 10644.0 MB 157 113 4426:58:10

NNRP total resource statistics [Top 20]:

SystemUser(ms)System(ms)Idle(ms)Elapsed
doctor.nl2k.ab.ca 14.557 22.666 0.000426:53:29
ts1p16.nl2k.ab.ca 0.188 0.099 0.00000:02:25
uucp.nk.ca 0.207 0.079 0.00000:01:37
159.186.132.66.censys-scanner.com 1.822 0.110 0.00000:00:16
91.195.132.66.censys-scanner.com 1.688 0.033 0.00000:00:05
r4-143-8f.monitoring.internet-measurement.com 0.233 0.008 0.00000:00:02
62.146.94.167.censys-scanner.com 2.341 0.064 0.00000:00:02
r4-216-d8.monitoring.internet-measurement.com 0.476 0.016 0.00000:00:01
r5-129-81.monitoring.internet-measurement.com 0.231 0.022 0.00000:00:01
r4-190-be.monitoring.internet-measurement.com 0.252 0.000 0.00000:00:00
r4-198-c6.monitoring.internet-measurement.com 0.244 0.008 0.00000:00:00
r5-196-c4.monitoring.internet-measurement.com 0.244 0.008 0.00000:00:00
r3-189-bd.monitoring.internet-measurement.com 0.250 0.000 0.00000:00:00
10.210.203.35.bc.googleusercontent.com 0.250 0.000 0.00000:00:00
r5-194-c2.monitoring.internet-measurement.com 0.225 0.016 0.00000:00:00
r5-215-d7.monitoring.internet-measurement.com 0.231 0.008 0.00000:00:00
221.211.203.35.bc.googleusercontent.com 0.144 0.052 0.00000:00:00
gallifrey.nk.ca 0.074 0.033 0.00000:00:00
53.146.94.167.censys-scanner.com 0.207 0.107 0.00000:00:00
172-234-217-129.ip.linodeusercontent.com 0.132 0.066 0.00000:00:00
TOTAL: 39 27.616 23.765 0.000426:58:12

Curious NNRP explorers [Top 20]:

SystemConn
62.146.94.167.censys-scanner.com 10
159.186.132.66.censys-scanner.com 8
91.195.132.66.censys-scanner.com 7
53.146.94.167.censys-scanner.com 3
172-234-217-129.ip.linodeusercontent.com 2
221.211.203.35.bc.googleusercontent.com 2
azpdsskv2v8p.stretchoid.com 2
r4-216-d8.monitoring.internet-measurement.com 2
10.210.203.35.bc.googleusercontent.com 1
198.235.24.196 1
216.226.76.20 1
69.5.169.69 1
69.5.169.88 1
gallifrey.nk.ca 1
r3-185-b9.monitoring.internet-measurement.com 1
r3-186-ba.monitoring.internet-measurement.com 1
r3-189-bd.monitoring.internet-measurement.com 1
r3-4-4.monitoring.internet-measurement.com 1
r3-8-8.monitoring.internet-measurement.com 1
r4-10-a.monitoring.internet-measurement.com 1
TOTAL: 39 67

NNRP no permission clients [Top 20]:

SystemConn
91.195.132.66.censys-scanner.com 4
53.146.94.167.censys-scanner.com 3
159.186.132.66.censys-scanner.com 2
172-234-217-129.ip.linodeusercontent.com 2
221.211.203.35.bc.googleusercontent.com 2
azpdsskv2v8p.stretchoid.com 2
10.210.203.35.bc.googleusercontent.com 1
198.235.24.196 1
216.226.76.20 1
69.5.169.69 1
69.5.169.88 1
r3-189-bd.monitoring.internet-measurement.com 1
r4-190-be.monitoring.internet-measurement.com 1
r4-198-c6.monitoring.internet-measurement.com 1
r4-216-d8.monitoring.internet-measurement.com 1
r5-129-81.monitoring.internet-measurement.com 1
r5-196-c4.monitoring.internet-measurement.com 1
TOTAL: 17 26

NNRP gethostbyaddr failures [Top 20]:

SystemConn
? (can't getpeername) 7
TOTAL: 1 7

NNRP unrecognized commands (by host) [Top 20]:

SystemConn
doctor.nl2k.ab.ca 8
uucp.nk.ca 1
TOTAL: 2 9

NNRP unrecognized commands (by command) [Top 20]:

CommandCount
XTHREAD DBINIT 9
TOTAL: 1 9

NNRP client timeouts [Top 20]:

SystemConnPeer
doctor.nl2k.ab.ca 10 0
TOTAL: 1 10 0

Newsgroup request counts (by hierarchy) [Top 100]:

HierarchyCountPct
1rec 834 80.3%
2can 100 9.6%
3microsoft 30 2.9%
4comp 26 2.5%
5alt 19 1.8%
6news 16 1.5%
7edm 9 0.9%
8soc 5 0.5%
TOTAL: 8 1039100.0%

Newsgroup request counts (by newsgroup) [Top 100]:

NewsgroupCount
1rec.arts.drwho 755
2can.politics 98
3rec.sport.soccer 55
4microsoft.public.windowsxp.help_and_support 30
5news.software.nntp 16
6rec.arts.sf.written 14
7comp.lang.c++ 10
8alt.christnet.christianlife 8
9comp.lang.javascript 8
10alt.christnet.bible 6
11edm.general 6
12comp.lang.c 4
13comp.os.linux.misc 4
14rec.arts.sf.fandom 4
15rec.arts.sf.tv 4
16soc.culture.europe 4
17alt.christnet 3
18edm.news.stats 3
19alt.christnet.prayer 2
20can.general 2
21rec.arts.sf.starwars.misc 2
22soc.culture.esperanto 1
TOTAL: 22 1039
innreport from INN 2.8.0 (20260714 snapshot) based on initial work (©) 1996-2001 by Fabien Tassin <fta@sofaraway.org> and enhanced by several contributors since then